PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g23270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family bZIP
Protein Properties Length: 726aa    MW: 78649.3 Da    PI: 6.7391
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g23270genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-13229290162
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Tp4g23270 229 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 290
                678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16229293IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11230291IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3231291IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-17233291No hitNo description
SuperFamilySSF579593.81E-12233291No hitNo description
CDDcd147044.41E-21234285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MAEPITEEPP PAPDPSSTLP PSGFDSISIP PFDQFYHSGS DQTPIGELMS DLGFPIDGDF  60
ELTFDGMEDL YLPSENETFL IPSVKVSNQE QFGDFTPESE GSGVSGDCVP KDAEKSIHRL  120
PSTSGCCNRE SPRDSDDRCS GAERMLVLPT PLSSQGSGNC GSDVSEATNE SSPKSGNVVV  180
DQKVKVEEAA TTSITKRKKE IEEDMSDESR SSKYRRSGED ADASAVTGEE DEKKKARLMR  240
NRESAQLSRQ RKKHYVEELE EKVRNMHSTI TDLNGKISYF MAENATLRQQ LGGNGMCPPH  300
HPPPPMGMYP PMAPMPYPWM PCPPYMVKQQ GSQVPLIPIP RLKPQNPLGS SKAKKSESKK  360
SETKTKKVAS ISFLGLLFCL FLFGALAPIV NVNYGGISGA FYGNYRSNYV TDQIYNQHRN  420
RVMDTSRSGA GSGVSNSNGM RSGRDSDRGP GKNISATESS VPPGNGSEPL VASLFVPRND  480
KLVKIDGNLI INSILASEKA VASRKASESN ERKADQVVPK DYSPALPLPD VGKIEDMAKH  540
LYRSKAEKQK ALSSGSADTL KDQIKTKAAN GEMQQWFREG VAGPMFSSGM CTEVFQFDVS  600
STSGAIIPAS SATNVSAENS KNATDTHRRK NRRTLRGLPI PLPGSDFNFT KEHQRNSSSK  660
EIKPASSMVV SVLVDPREGG DGDIDGIIGG PKSLSRVFVV VLLDSAKYVT YSCVLPRAGA  720
PHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein